Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 2-70D (HV70D)

This Recombinant Human Immunoglobulin heavy variable 2-70D (HV70D) spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 2-70D IGHV2-70D

UniProt

A0A0C4DH43

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTLKESGPALVKPTQTLTLTCTFSGFSLSTSGMRVSWIRQPPGKALEWLARIDWDDDKFYSTSLKTRLTISKDTSKNQVVLTMTNMDPVDTATYYCARI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCARNA17 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2097607 1.0 µg DNA

SCARNA17 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
CDRT15 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0422507 1.0 µg DNA

CDRT15 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Anti-Human TRPV2 Antibody (SAA1926)
MBS1570886-01 0.1 mg

Anti-Human TRPV2 Antibody (SAA1926)

Sign In for Pricing
View Details
Anti-Human TRPV2 Antibody (SAA1926)
MBS1570886-02 1 mg

Anti-Human TRPV2 Antibody (SAA1926)

Sign In for Pricing
View Details
Anti-Human TRPV2 Antibody (SAA1926)
MBS1570886-03 5x 1 mg

Anti-Human TRPV2 Antibody (SAA1926)

Sign In for Pricing
View Details
TECTB siRNA (Mouse)
CRM4085-01 15 nmol

TECTB siRNA (Mouse)

Sign In for Pricing
View Details