Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human DPEP2 neighbor protein (DP2NB)

This Recombinant Human DPEP2 neighbor protein (DP2NB) spans the amino acid sequence from region 1-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DPEP2 neighbor protein DPEP2NB

UniProt

A0A0U1RQF7

Expression Region

1-123

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTDRILYIVSNMSSVPWEGSAAAAVPATSPPTPGHYHVLYRGCGETQVGWHGETYCLVGGYRVHGDAPLATPTKAEAEKPAPRRAPKRRQATIESDKDLGCSSPKIRRLEHRGRRLTPQKLAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rhesus Macaque NUDT9 Protein, His (Fc)-Avi-tagged
NUDT9-2950R 50 µg

Recombinant Rhesus Macaque NUDT9 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Olr1605 Protein Vector (Rat) (pPM-C-His)
PV288717 500 ng

Olr1605 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Isorhamnetin-3-O-neohespeidoside
N2516-20 20 mg

Isorhamnetin-3-O-neohespeidoside

Sign In for Pricing
View Details
ZNF420 Antibody
orb684456 100 µL

ZNF420 Antibody

Sign In for Pricing
View Details
Anti-Mouse/Rat IL-17A PE
MBS697192-01 0.05 mg

Anti-Mouse/Rat IL-17A PE

Sign In for Pricing
View Details
Anti-Mouse/Rat IL-17A PE
MBS697192-02 5x 0.05 mg

Anti-Mouse/Rat IL-17A PE

Sign In for Pricing
View Details