Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human DPEP2 neighbor protein (DP2NB)

This Recombinant Human DPEP2 neighbor protein (DP2NB) spans the amino acid sequence from region 1-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DPEP2 neighbor protein DPEP2NB

UniProt

A0A0U1RQF7

Expression Region

1-123

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTDRILYIVSNMSSVPWEGSAAAAVPATSPPTPGHYHVLYRGCGETQVGWHGETYCLVGGYRVHGDAPLATPTKAEAEKPAPRRAPKRRQATIESDKDLGCSSPKIRRLEHRGRRLTPQKLAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MST1 (+MST2) Rabbit Polyclonal Antibody
AP06540PU-N 100 µg

MST1 (+MST2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Nesprin 2 Protein - (Dry Ice)
H00023224-Q01-10ug 10 µg

Recombinant Human Nesprin 2 Protein - (Dry Ice)

Sign In for Pricing
View Details
HSPE1 Rabbit Polyclonal Antibody (RBITC)
orb1040908 100 µL

HSPE1 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Anti-Cytokeratin 8 Rabbit Monoclonal Antibody
M01421-6-40μl 40 µL

Anti-Cytokeratin 8 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PAK5/PAK6 Antibody
orb672978-01 50 µg

PAK5/PAK6 Antibody

Sign In for Pricing
View Details
PAK5/PAK6 Antibody
orb672978-02 100 µg

PAK5/PAK6 Antibody

Sign In for Pricing
View Details