Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-4 (TVB74)

This Recombinant Human T cell receptor beta variable 7-4 (TVB74) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-4 TRBV7-4

UniProt

A0A1B0GX95

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVAKRGRDVALRCDSISGHVTLYWYRQTLGQGSEVLTYSQSDAQRDKSGRPSGRFSAERPERSVSTLKIQRTEQGDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CYCS Protein, His Tag
E40KMH965 20 µg

Recombinant Human CYCS Protein, His Tag

Sign In for Pricing
View Details
SMARCAD1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
44411066 1.0 µg DNA

SMARCAD1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human Laminin Subunit Gamma-1 (Lamc1) Elisa Kit
EKC41736 96 Tests

Human Laminin Subunit Gamma-1 (Lamc1) Elisa Kit

Sign In for Pricing
View Details
Blasticidin S Hydrochloride
40210012-3 250 mg

Blasticidin S Hydrochloride

Sign In for Pricing
View Details
DDX23 antibody
FNab02300 100 µg

DDX23 antibody

Sign In for Pricing
View Details
Human Laminin Gamma 3 (LAMC3) Protein
abx168186-01 10 µg

Human Laminin Gamma 3 (LAMC3) Protein

Sign In for Pricing
View Details