Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-4 (TVB74)

This Recombinant Human T cell receptor beta variable 7-4 (TVB74) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-4 TRBV7-4

UniProt

A0A1B0GX95

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVAKRGRDVALRCDSISGHVTLYWYRQTLGQGSEVLTYSQSDAQRDKSGRPSGRFSAERPERSVSTLKIQRTEQGDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-[ (2-Fluorobenzyl) oxy]azetidine hydrochloride
sc-311989 500 mg

3-[ (2-Fluorobenzyl) oxy]azetidine hydrochloride

Sign In for Pricing
View Details
BRAF inhibitor
C03966 5 mg

BRAF inhibitor

Sign In for Pricing
View Details
RNF128
CSB-CL837448HU 10 μg Plasmid + 200 μL Glycerol

RNF128

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (C31/1395R), CF594 conjugate, 0.1mg/mL
BNC941395-500 1x 500 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (C31/1395R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human VARS2 knockdown cell line
ABC-KD16709 1 Vial

Human VARS2 knockdown cell line

Sign In for Pricing
View Details
RIOK2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
39606154 3x 1.0 µg DNA

RIOK2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details