Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-6 (TVB56)

This Recombinant Human T cell receptor beta variable 5-6 (TVB56) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-6 TRBV5-6 TCRBV5S2

UniProt

A0A599

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSPKSGHDTVSWYQQALGQGPQFIFQYYEEEERQRGNFPDRFSGHQFPNYSSELNVNALLLGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD21 (CR2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10C2]
TA814232BM 100 µL

CD21 (CR2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10C2]

Sign In for Pricing
View Details
Congo Red maleimide
23070-AAT 5 mg

Congo Red maleimide

Sign In for Pricing
View Details
5-Acetamidonaphthalene-1-sulfonyl Chloride
TRC-A158465-5G 5 g

5-Acetamidonaphthalene-1-sulfonyl Chloride

Sign In for Pricing
View Details
DCAF5 Human Gene Knockout Kit (CRISPR)
KN424523 1 Kit

DCAF5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse RANκL Antibody Pair Set
E-KAB-0571 50 µL & 100 µg

Mouse RANκL Antibody Pair Set

Sign In for Pricing
View Details
N,N'-Carbonylbis[L-glutamic Acid]
TRC-C177308-50MG 50 mg

N,N'-Carbonylbis[L-glutamic Acid]

Sign In for Pricing
View Details