Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-6 (TVB56)

This Recombinant Human T cell receptor beta variable 5-6 (TVB56) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-6 TRBV5-6 TCRBV5S2

UniProt

A0A599

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSPKSGHDTVSWYQQALGQGPQFIFQYYEEEERQRGNFPDRFSGHQFPNYSSELNVNALLLGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABA A Receptor alpha 5 (GABRA5) Human Gene Knockout Kit (CRISPR)
KN416541 1 Kit

GABA A Receptor alpha 5 (GABRA5) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD50 / ICAM3 (ICAM3/2873R), CF740 conjugate, 0.1mg/mL
BNC742873-500 1x 500 µL

CD50 / ICAM3 (ICAM3/2873R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: left
CS714154 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details
Human BACE1 Recombinant Rabbit monoclonal Antibody
HA725172 100 µL

Human BACE1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: left
CS638840 5x 5 µm

Frozen Tissue Sections, Colon: left

Sign In for Pricing
View Details
Octafluoroadipic Acid
TRC-O148533-1G 1 g

Octafluoroadipic Acid

Sign In for Pricing
View Details