Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-6 (TVB56)

This Recombinant Human T cell receptor beta variable 5-6 (TVB56) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-6 TRBV5-6 TCRBV5S2

UniProt

A0A599

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSPKSGHDTVSWYQQALGQGPQFIFQYYEEEERQRGNFPDRFSGHQFPNYSSELNVNALLLGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC8A1 Adenovirus (Mouse)
44289054 1.0 mL

SLC8A1 Adenovirus (Mouse)

Sign In for Pricing
View Details
Anti-LRRC75A Antibody Picoband®, FITC Conjugate
A18461-1-FITC 100 µg/Vial

Anti-LRRC75A Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Phospho-EGFR (Tyr1068) (Clone: E5) rabbit mAb SureLight488 conjugate
12-4072-10 10 Tests

Phospho-EGFR (Tyr1068) (Clone: E5) rabbit mAb SureLight488 conjugate

Sign In for Pricing
View Details
Hyi Mouse shRNA Plasmid (Locus ID 68180)
TR514874 1 Kit

Hyi Mouse shRNA Plasmid (Locus ID 68180)

Sign In for Pricing
View Details
anti-PHACS
YF-PA21455 100 ul

anti-PHACS

Sign In for Pricing
View Details
Tsta3 (NM_031201) Mouse Recombinant Protein
PM47305M5 20 µg

Tsta3 (NM_031201) Mouse Recombinant Protein

Sign In for Pricing
View Details