Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SLC35A4 upstream open reading frame protein (S35U4), partial

This Recombinant Human SLC35A4 upstream open reading frame protein (S35U4), partial spans the amino acid sequence from region 1-61. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SLC35A4 upstream open reading frame protein; SLC35A4 microprotein; SLC35A4-MP; SLC35A4

UniProt

L0R6Q1

Expression Region

1-61

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MADDKDSLPKLKDLAFLKNQLESLQRRVEDEVNSGVGQDGSLLSSPFLKGFLAGYVVAKLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl Thiooxamate
TRC-E926850-25G 25 g

Ethyl Thiooxamate

Sign In for Pricing
View Details
Human ZNF367 activation kit by CRISPRa
GA116260 1 Kit

Human ZNF367 activation kit by CRISPRa

Sign In for Pricing
View Details
VASP Rabbit Polyclonal Antibody
TA383198 100 µL

VASP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD8a Antibody[YTS 105.18]
AN00331M-01 50 Tests

Elab Fluor® 647 Anti-Mouse CD8a Antibody[YTS 105.18]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD8a Antibody[YTS 105.18]
AN00331M-02 100 Tests

Elab Fluor® 647 Anti-Mouse CD8a Antibody[YTS 105.18]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD8a Antibody[YTS 105.18]
AN00331M-03 2x 100 Tests

Elab Fluor® 647 Anti-Mouse CD8a Antibody[YTS 105.18]

Sign In for Pricing
View Details