Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-38-2 (HVD82)

This Recombinant Human Immunoglobulin heavy variable 4-38-2 (HVD82) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-38-2 IGHV4-38-2

UniProt

P0DP08

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSETLSLTCTVSGYSISSGYYWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp36 Mouse Pre-designed siRNA Set A
HY-RS18557 1 Set

Zfp36 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
DBF4B (NM_025104) Human Tagged ORF Clone Lentiviral Particle
RC220136L4V 200 µL

DBF4B (NM_025104) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
POTEG CRISPRa sgRNA lentivector (set of three targets)(Human)
37248121 3x 1.0µg DNA

POTEG CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Human WNT7A Recombinant Protein
PPT-16062 100 µg

Human WNT7A Recombinant Protein

Sign In for Pricing
View Details
Bovine NELL2/Protein Kinase C-Binding Protein NELL2 ELISA Kit
MBS2890866-01 48 Well

Bovine NELL2/Protein Kinase C-Binding Protein NELL2 ELISA Kit

Sign In for Pricing
View Details
Bovine NELL2/Protein Kinase C-Binding Protein NELL2 ELISA Kit
MBS2890866-02 96 Well

Bovine NELL2/Protein Kinase C-Binding Protein NELL2 ELISA Kit

Sign In for Pricing
View Details