Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-38-2 (HVD82)

This Recombinant Human Immunoglobulin heavy variable 4-38-2 (HVD82) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-38-2 IGHV4-38-2

UniProt

P0DP08

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSETLSLTCTVSGYSISSGYYWGWIRQPPGKGLEWIGSIYHSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal GTPBP3 Antibody
NBP2-87544 100 µL

Rabbit Polyclonal GTPBP3 Antibody

Sign In for Pricing
View Details
INPP5K Antibody - N-terminal region : HRP (ARP61153_P050-HRP)
ARP61153_P050-HRP 100 µL

INPP5K Antibody - N-terminal region : HRP (ARP61153_P050-HRP)

Sign In for Pricing
View Details
(R) -2-Amino-2- (2- (trifluoromethyl) phenyl) ethan-1-ol hydrochloride
PC1003596-01 100 mg

(R) -2-Amino-2- (2- (trifluoromethyl) phenyl) ethan-1-ol hydrochloride

Sign In for Pricing
View Details
(R) -2-Amino-2- (2- (trifluoromethyl) phenyl) ethan-1-ol hydrochloride
PC1003596-02 250 mg

(R) -2-Amino-2- (2- (trifluoromethyl) phenyl) ethan-1-ol hydrochloride

Sign In for Pricing
View Details
SYCE1 Protein Vector (Mouse) (pPB-N-His)
PV235551 500 ng

SYCE1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
N-[4- (sec-Butoxy) phenyl]-N-[2- (1-naphthyl) ethyl]-amine
sc-330988 500 mg

N-[4- (sec-Butoxy) phenyl]-N-[2- (1-naphthyl) ethyl]-amine

Sign In for Pricing
View Details