Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neuropeptide Y receptor type 4-2 (NPY42), partial

This Recombinant Human Neuropeptide Y receptor type 4-2 (NPY42), partial spans the amino acid sequence from region 1-39. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Neuropeptide Y receptor type 4-2 NPY4R2

UniProt

P0DQD5

Expression Region

1-39

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Keratin 12 (KRT12) Rabbit Polyclonal Antibody
TA372853 100 µL

Keratin 12 (KRT12) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human 14-3-3 theta (YWHAQ) activation kit by CRISPRa
GA107531 1 Kit

Human 14-3-3 theta (YWHAQ) activation kit by CRISPRa

Sign In for Pricing
View Details
CD80 (B7-1) (C80/2725), CF405S conjugate, 0.1mg/mL
BNC042725-100 1x 100 µL

CD80 (B7-1) (C80/2725), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Aurora B (Proliferation Marker) (AURKB/3121R), CF647 conjugate, 0.1mg/mL
BNC473121-500 1x 500 µL

Aurora B (Proliferation Marker) (AURKB/3121R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human PRUNE (PRUNE1) activation kit by CRISPRa
GA111780 1 Kit

Human PRUNE (PRUNE1) activation kit by CRISPRa

Sign In for Pricing
View Details
Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG1707R), Biotin conjugate, 0.1mg/mL
BNCB1707-500 1x 500 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG1707R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details