Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Splicing regulatory small protein (SRSP)

This Recombinant Human Splicing regulatory small protein (SRSP) spans the amino acid sequence from region 1-130. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Splicing regulatory small protein SRSP

UniProt

P0DXC1

Expression Region

1-130

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRTKPQRPRATRSYLGQPCGSPRRTEETGETWERVAFSLFTHTCTQPLAGTVDTHLPSLLLPVILHPLGAASAGRALEPKADPHTCPYGRKESRGEKVRRGRAKSNSGPNVPGPPAAPQSLKSGSPSTRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAMK2D Antibody
ABD9300 100 µg

CAMK2D Antibody

Sign In for Pricing
View Details
MRP8/14 (S100A8/A9) Mouse Monoclonal Antibody [Clone ID: FP 93]
AM33180PU-S 10 µg

MRP8/14 (S100A8/A9) Mouse Monoclonal Antibody [Clone ID: FP 93]

Sign In for Pricing
View Details
Tipifarnib
C07808-50mg 50 mg

Tipifarnib

Sign In for Pricing
View Details
Anti-SDHB Antibody Picoband® Fluoro594 Conjugated
PA1718-Fluoro594 100 µg/Vial

Anti-SDHB Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 4 (FGF4) ELISA Kit
RDR-FGF4-Mu-96Tests 96 Tests

Mouse Fibroblast Growth Factor 4 (FGF4) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Cytochrome P450 2E1 Antibody (OTI5B9) [DyLight 550]
NBP2-70531R 0.1 mL

Mouse Monoclonal Cytochrome P450 2E1 Antibody (OTI5B9) [DyLight 550]

Sign In for Pricing
View Details