Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Splicing regulatory small protein (SRSP)

This Recombinant Human Splicing regulatory small protein (SRSP) spans the amino acid sequence from region 1-130. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Splicing regulatory small protein SRSP

UniProt

P0DXC1

Expression Region

1-130

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRTKPQRPRATRSYLGQPCGSPRRTEETGETWERVAFSLFTHTCTQPLAGTVDTHLPSLLLPVILHPLGAASAGRALEPKADPHTCPYGRKESRGEKVRRGRAKSNSGPNVPGPPAAPQSLKSGSPSTRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kremen, CT (Kremen protein 1, Kringle-containing Protein Marking The Eye And The Nose, Kringle Domain-containing Transmembrane Protein 1, Dickkopf Receptor, KREMEN1, KRM1) (Biotin) discontinued
K5000-01A-Biotin 200 µL

Kremen, CT (Kremen protein 1, Kringle-containing Protein Marking The Eye And The Nose, Kringle Domain-containing Transmembrane Protein 1, Dickkopf Receptor, KREMEN1, KRM1) (Biotin) discontinued

Sign In for Pricing
View Details
Recombinant Human PKDREJ Protein
E30P2824 20 µg

Recombinant Human PKDREJ Protein

Sign In for Pricing
View Details
DLL4 Protein (C-His, Mouse)
P514787 100 µg

DLL4 Protein (C-His, Mouse)

Sign In for Pricing
View Details
PRPF31 Antibody
C11412-01 50 μL

PRPF31 Antibody

Sign In for Pricing
View Details
PRPF31 Antibody
C11412-02 100 µL

PRPF31 Antibody

Sign In for Pricing
View Details
Sp1 Protein Vector (Mouse) (pPM-C-HA)
PV232840 500 ng

Sp1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details