Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc finger protein 722 (ZN722)

This Recombinant Human Zinc finger protein 722 (ZN722) spans the amino acid sequence from region 1-384. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zinc finger protein 722 ZNF722 ZNF722P

UniProt

A0A1W2PQL4

Expression Region

1-384

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAERPGSPGSREMRLLTFRDIAIEFSLEEWQCLDCAQQNLYRDVMLENYRNLVSLGIADSKPDLITCLEQNKEAWNIKRNEMVAKHPVTCSHFTQDLHPEQGIKHSLQKVIPRTYGKCGHENLQFKKCCKSVGECEVHKGGYNEVKQCLSNTQNKIFQTHKCVIVFGKFSNCNRHETRYTGKKHFKCKKYGKSFCMPSHLNQHQIIHTKEKSYKCEECGKSFKRSSNCTTHKRIHTGEKPYRCEECGKAFRWPSNLTRHKRIHTGEKPYTCEECGQAFRRSSTLTNHKRIHTGERPYKCEECGKAFSVSSTLNDHKRIHTGEKPYTCEECGRAFNCSSTLKTHKRIHTGEKPYKCEECDKAFKRHSSLAKHKIIHTGEKPYKSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-EAF2 Antibody
MBS4510635-01 0.05 mL

Rabbit anti-EAF2 Antibody

Sign In for Pricing
View Details
Rabbit anti-EAF2 Antibody
MBS4510635-02 0.1 mL

Rabbit anti-EAF2 Antibody

Sign In for Pricing
View Details
Rabbit anti-EAF2 Antibody
MBS4510635-03 5x 0.1 mL

Rabbit anti-EAF2 Antibody

Sign In for Pricing
View Details
Rne Antibody
orb808540 2 mg

Rne Antibody

Sign In for Pricing
View Details
HRAS Antibody
ABD7960 100 µg

HRAS Antibody

Sign In for Pricing
View Details
FRAT2 Polyclonal Antibody, Cy5 Conjugated
bs-12435R-Cy5 100 µL

FRAT2 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details