Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Speedy protein E9 (SPD9)

This Recombinant Human Speedy protein E9 (SPD9) spans the amino acid sequence from region 1-265. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Speedy protein E9 SPDYE9

UniProt

A0A494C191

Expression Region

1-265

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGQILGKIMMSHQPQPQEERSPQRSTSGYPLQEVVDDEVSGPSAPGVDPSPPRRSLGWKRKRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPVIKRLLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEAPKQNIFYFLYEETRSHIPLLSELWFQLCRYMNPRARKNCSQIALFRKYRFHFFCSMRCRAWVSLEELEEIQAYDPEHWVWARDRAHLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKR1B1 Rabbit Polyclonal Antibody (Fluoro647)
orb3079626 100 µg

AKR1B1 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
TNRC6B Protein Vector (Human) (pPB-C-His)
PV136550 500 ng

TNRC6B Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Interferon beta (IFN-beta, IFNb, IFB, IFF, IFNB1, Fibroblast Interferon, MGC96956) (MaxLight 550) discontinued
I7662-10J-ML550 100 µL

Interferon beta (IFN-beta, IFNb, IFB, IFF, IFNB1, Fibroblast Interferon, MGC96956) (MaxLight 550) discontinued

Sign In for Pricing
View Details
PECMV-3xFLAG-SIX1 (human)
BZ23305 1 Vial

PECMV-3xFLAG-SIX1 (human)

Sign In for Pricing
View Details
FoxE3 Polyclonal Antibody
orb1413700 100 µL

FoxE3 Polyclonal Antibody

Sign In for Pricing
View Details
Propofol sulfate (sodium)
HY-172549 1 Each

Propofol sulfate (sodium)

Sign In for Pricing
View Details