Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ankyrin repeat domain-containing protein 66 (ANR66)

This Recombinant Human Ankyrin repeat domain-containing protein 66 (ANR66) spans the amino acid sequence from region 1-196. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ankyrin repeat domain-containing protein 66 ANKRD66

UniProt

B4E2M5

Expression Region

1-196

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MELAKMSDMTKLHQAVAAGDYSLVKKILKKGLCDPNYKDVDWNDRTPLHWAAIKGQMEVIRLLIEYGARPCLVTSVGWTPAHFAAEAGHLNILKTLHALHAAIDAPDFFGDTPKRIAQIYGQKACVAFLEKAEPECQDHRCAAQQKGLPLDERDEDWDAKKRELELSLPSLNQNMNKKNKKSRGPTRPSNTKGRRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SLC39A3 Antibody [DyLight 488]
NBP1-76500G 0.1 mL

Rabbit Polyclonal SLC39A3 Antibody [DyLight 488]

Sign In for Pricing
View Details
DPP9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0628407 1.0 µg DNA

DPP9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
CDK2, Phosphorylated (Thr14) (Cell Division Protein Kinase 2, p33 Protein Kinase) (FITC)
MBS6468503-01 0.2 mL

CDK2, Phosphorylated (Thr14) (Cell Division Protein Kinase 2, p33 Protein Kinase) (FITC)

Sign In for Pricing
View Details
CDK2, Phosphorylated (Thr14) (Cell Division Protein Kinase 2, p33 Protein Kinase) (FITC)
MBS6468503-02 5x 0.2 mL

CDK2, Phosphorylated (Thr14) (Cell Division Protein Kinase 2, p33 Protein Kinase) (FITC)

Sign In for Pricing
View Details
Mouse Monoclonal ZNF307 Antibody (OTI6G6) [Dylight 594]
NBP2-74936DL594 0.1 mL

Mouse Monoclonal ZNF307 Antibody (OTI6G6) [Dylight 594]

Sign In for Pricing
View Details
FABP3/H-FABP Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61568R-BF594-TR 20 µL

FABP3/H-FABP Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details