Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 7 (SMIM7), partial

This Recombinant Human Small integral membrane protein 7 (SMIM7), partial spans the amino acid sequence from region 18-53. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 7 SMIM7 C19orf42

UniProt

Q9BQ49

Expression Region

18-53

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VLNFKLKKKDTQGFGEESREPSTGDNIREFLLSLRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit for 5'-Nucleotidase, Cytosolic IB (NT5C1B)
TRV-0063989-01 24 Tests

ELISA Kit for 5'-Nucleotidase, Cytosolic IB (NT5C1B)

Sign In for Pricing
View Details
ELISA Kit for 5'-Nucleotidase, Cytosolic IB (NT5C1B)
TRV-0063989-02 48 Tests

ELISA Kit for 5'-Nucleotidase, Cytosolic IB (NT5C1B)

Sign In for Pricing
View Details
ELISA Kit for 5'-Nucleotidase, Cytosolic IB (NT5C1B)
TRV-0063989-03 96 Tests

ELISA Kit for 5'-Nucleotidase, Cytosolic IB (NT5C1B)

Sign In for Pricing
View Details
ELISA Kit for 5'-Nucleotidase, Cytosolic IB (NT5C1B)
TRV-0063989-04 5x 96 Tests

ELISA Kit for 5'-Nucleotidase, Cytosolic IB (NT5C1B)

Sign In for Pricing
View Details
ELISA Kit for 5'-Nucleotidase, Cytosolic IB (NT5C1B)
TRV-0063989-05 10x 96 Tests

ELISA Kit for 5'-Nucleotidase, Cytosolic IB (NT5C1B)

Sign In for Pricing
View Details
Alexa Fluor® 700 anti-mouse H-2Kd
GT02414 100 µg

Alexa Fluor® 700 anti-mouse H-2Kd

Sign In for Pricing
View Details