Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 7 (SMIM7), partial

This Recombinant Human Small integral membrane protein 7 (SMIM7), partial spans the amino acid sequence from region 18-53. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 7 SMIM7 C19orf42

UniProt

Q9BQ49

Expression Region

18-53

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VLNFKLKKKDTQGFGEESREPSTGDNIREFLLSLRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Brucella abortus Lectin-like protein BA14k (BAbS19_II04750)
MBS1101650 Inquire

Recombinant Brucella abortus Lectin-like protein BA14k (BAbS19_II04750)

Sign In for Pricing
View Details
U2AF1 Antibody
E307198 100 µg - 200 µL

U2AF1 Antibody

Sign In for Pricing
View Details
MRPS34 Protein Vector (Rat) (pPB-C-His)
PV283302 500 ng

MRPS34 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
KISS1 (KiSS-1 Metastasis-Suppressor, KiSS-1, METASTIN, MGC39258) (APC)
247920-APC 100 µL

KISS1 (KiSS-1 Metastasis-Suppressor, KiSS-1, METASTIN, MGC39258) (APC)

Sign In for Pricing
View Details
Oryzacystatin-12 Rabbit Polyclonal Antibody
E580535-A-SE 100 µL

Oryzacystatin-12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Orange Superior Hi-Vis Traffic Jacket Class 3 Size Small - EACH
SAF3588 1 Each

Orange Superior Hi-Vis Traffic Jacket Class 3 Size Small - EACH

Sign In for Pricing
View Details