Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 7 (SMIM7), partial

This Recombinant Human Small integral membrane protein 7 (SMIM7), partial spans the amino acid sequence from region 18-53. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 7 SMIM7 C19orf42

UniProt

Q9BQ49

Expression Region

18-53

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VLNFKLKKKDTQGFGEESREPSTGDNIREFLLSLRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tbp sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4345204 1.0 µg DNA

Tbp sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
AGBL1 Protein Lysate (Human) with C-Ha Tag
11504031 100 µg

AGBL1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
KV1.1 siRNA (m)
sc-35767 10 µM

KV1.1 siRNA (m)

Sign In for Pricing
View Details
Carbonic Anhydrase 3 (CA3) Mouse ELISA Kit
C1247 96 Tests

Carbonic Anhydrase 3 (CA3) Mouse ELISA Kit

Sign In for Pricing
View Details
Myh3 Rat shRNA Plasmid (Locus ID 24583)
TL709247 1 Kit

Myh3 Rat shRNA Plasmid (Locus ID 24583)

Sign In for Pricing
View Details
Lentiviral human XXYLT1 shRNA (UAS) - Lentiviral human XXYLT1 shRNA (UAS, GFP) (100)
GTR15312336 1 Vial

Lentiviral human XXYLT1 shRNA (UAS) - Lentiviral human XXYLT1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details