Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Stabilizer of axonemal microtubules 3 (SAXO3)

This Recombinant Human Stabilizer of axonemal microtubules 3 (SAXO3) spans the amino acid sequence from region 1-334. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Stabilizer of axonemal microtubules 3 SAXO3

UniProt

A0A1B0GTJ6

Expression Region

1-334

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MASGTLAPGCRISATEVPGSRPNCHLTSSYFSHRIIPPIPFTPPTVQSTVADPLPQVAKQDSHNWAFDEVLSRWETTSGSAYVPKTHGGPCAQPRAPEPADPTRTVGIKDLGEKLRHRGWRLPLTTKYQSSETRAQYTGSPSGDPRAPEYFGPQPPQLADHHRGGPSQALIAWTKNPELSGRPFTVSDRGVLDRRQLYLTTSARDFRFYPKTELSGYPRKDSLTYWSFEETPQVWSHGPQRPPCPRSSRPPRPPRVRVPRVSPVTSAMPHRGALSLAQESYSPLLHPLRRLDRFCPLEAPWGGPHWKPLRGIYSVPKAYSTENSSYGSLKPALV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TTC5 shRNA (UAS) - Lentiviral human TTC5 shRNA (UAS, iRFP) plasmid
GTR15146272 1 Vial

Lentiviral human TTC5 shRNA (UAS) - Lentiviral human TTC5 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Recombinant Haemophilus Influenzae rpmI Protein (aa 1-65)
VAng-Lsx03786-50gEcoli 50 µg (E. coli)

Recombinant Haemophilus Influenzae rpmI Protein (aa 1-65)

Sign In for Pricing
View Details
NEK9 Rabbit Polyclonal Antibody (APC)
orb1008968 100 µL

NEK9 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
E2F5 Rabbit Polyclonal Antibody (Biotin)
orb457847 100 µL

E2F5 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Anti Sheep IgG (H+L) Rabbit Polyclonal
A2010006 1 Each

Anti Sheep IgG (H+L) Rabbit Polyclonal

Sign In for Pricing
View Details
IGF1 Rabbit Polyclonal Antibody
E53P07361 100 µL

IGF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details