Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 54 (TEX54)

This Recombinant Human Testis-expressed protein 54 (TEX54) spans the amino acid sequence from region 1-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 54 TEX54

UniProt

A0A1B0GVG6

Expression Region

1-124

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCQDKDFEMSDEQSKEEESEDGREDETTDTQRGPRECERGLPEGRGELRGLVVPSGAEDIDLNSPDHPNHKSNESLLITVLWRRLSTFGRRGSSRPSKRQPDQIRKQESPIREGNQEEPEKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHFR / DHFRP1 Mouse Monoclonal Antibody [Clone ID: AT5B2]
AM50636PU-N 100 µL

DHFR / DHFRP1 Mouse Monoclonal Antibody [Clone ID: AT5B2]

Sign In for Pricing
View Details
2-Phenylpropionic Acid Ethyl Ester
TRC-P336180-25MG 25 mg

2-Phenylpropionic Acid Ethyl Ester

Sign In for Pricing
View Details
Alkaline Phosphatase (ALPL/597), CF594 conjugate, 0.1mg/mL
BNC940597-100 1x 100 µL

Alkaline Phosphatase (ALPL/597), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS702796 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
Bcl-2 (124), CF647 conjugate, 0.1mg/mL
BNC470530-100 1x 100 µL

Bcl-2 (124), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (C66/195), 0.2mg/mL
BNUB0195-100 1x 100 µL

CD66 (CEA) (C66/195), 0.2mg/mL

Sign In for Pricing
View Details