Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 54 (TEX54)

This Recombinant Human Testis-expressed protein 54 (TEX54) spans the amino acid sequence from region 1-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 54 TEX54

UniProt

A0A1B0GVG6

Expression Region

1-124

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCQDKDFEMSDEQSKEEESEDGREDETTDTQRGPRECERGLPEGRGELRGLVVPSGAEDIDLNSPDHPNHKSNESLLITVLWRRLSTFGRRGSSRPSKRQPDQIRKQESPIREGNQEEPEKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 18 (KRT18/834), CF405S conjugate, 0.1mg/mL
BNC040834-500 1x 500 µL

Cytokeratin 18 (KRT18/834), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LGSN (NM_016571) Human Recombinant Protein
TP320287L 1 mg

LGSN (NM_016571) Human Recombinant Protein

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1372), 0.2mg/mL
BNUB1372-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1372), 0.2mg/mL

Sign In for Pricing
View Details
4-Fluoro-3-nitroaniline
TRC-F621950-50G 50 g

4-Fluoro-3-nitroaniline

Sign In for Pricing
View Details
Colloidal Gold Labeled Deoxyribonuclease (DNase 1), 1mL 10nm
GE-02-10 1 mL

Colloidal Gold Labeled Deoxyribonuclease (DNase 1), 1mL 10nm

Sign In for Pricing
View Details
FHL1 (NM_001159700) Human Over-expression Lysate
LC431827 20 µg

FHL1 (NM_001159700) Human Over-expression Lysate

Sign In for Pricing
View Details