Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 54 (TEX54)

This Recombinant Human Testis-expressed protein 54 (TEX54) spans the amino acid sequence from region 1-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 54 TEX54

UniProt

A0A1B0GVG6

Expression Region

1-124

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCQDKDFEMSDEQSKEEESEDGREDETTDTQRGPRECERGLPEGRGELRGLVVPSGAEDIDLNSPDHPNHKSNESLLITVLWRRLSTFGRRGSSRPSKRQPDQIRKQESPIREGNQEEPEKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cleaved-COL1A2 (G1102) Rabbit Polyclonal Antibody
APRab08982-01 20 µL

Cleaved-COL1A2 (G1102) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cleaved-COL1A2 (G1102) Rabbit Polyclonal Antibody
APRab08982-02 50 µL

Cleaved-COL1A2 (G1102) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cleaved-COL1A2 (G1102) Rabbit Polyclonal Antibody
APRab08982-03 100 µL

Cleaved-COL1A2 (G1102) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cleaved-COL1A2 (G1102) Rabbit Polyclonal Antibody
APRab08982-04 200 µL

Cleaved-COL1A2 (G1102) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PI3KC3, Phosphorylated (Ser164) (Phosphatidylinositol 3-kinase Catalytic Subunit Type 3, PtdIns-3-kinase Type 3, PI3-kinase Type 3, PI3K Type 3, Phosphoinositide-3-kinase Class 3, Phosphatidylinositol 3-Kinase p100 Subunit, hVps34, VPS34) (Biotin)
MBS6493223-01 0.2 mL

PI3KC3, Phosphorylated (Ser164) (Phosphatidylinositol 3-kinase Catalytic Subunit Type 3, PtdIns-3-kinase Type 3, PI3-kinase Type 3, PI3K Type 3, Phosphoinositide-3-kinase Class 3, Phosphatidylinositol 3-Kinase p100 Subunit, hVps34, VPS34) (Biotin)

Sign In for Pricing
View Details
PI3KC3, Phosphorylated (Ser164) (Phosphatidylinositol 3-kinase Catalytic Subunit Type 3, PtdIns-3-kinase Type 3, PI3-kinase Type 3, PI3K Type 3, Phosphoinositide-3-kinase Class 3, Phosphatidylinositol 3-Kinase p100 Subunit, hVps34, VPS34) (Biotin)
MBS6493223-02 5x 0.2 mL

PI3KC3, Phosphorylated (Ser164) (Phosphatidylinositol 3-kinase Catalytic Subunit Type 3, PtdIns-3-kinase Type 3, PI3-kinase Type 3, PI3K Type 3, Phosphoinositide-3-kinase Class 3, Phosphatidylinositol 3-Kinase p100 Subunit, hVps34, VPS34) (Biotin)

Sign In for Pricing
View Details