Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thrombospondin type-1 domain-containing protein 8 (THSD8)

This Recombinant Human Thrombospondin type-1 domain-containing protein 8 (THSD8) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thrombospondin type-1 domain-containing protein 8 THSD8

UniProt

A0A1W2PP97

Expression Region

22-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ALVYQDYQYLGQQGEGDSWEQLRLQHLKEVEDSILGPWGKWRCLCDLGKQERSREVVGTAPGPVFMDPEKLIQLRPCRQRDCPSCKPFDCDWRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CA4 Antibody
A15724-100UG 100 µg

CA4 Antibody

Sign In for Pricing
View Details
Human ZSCAN25 Pre-designed siRNA Set A
SI019172A 1 Each

Human ZSCAN25 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Nori® Human 2-Plex ELISA Kits-CRP/AGP
GR230174 96 Well

Nori® Human 2-Plex ELISA Kits-CRP/AGP

Sign In for Pricing
View Details
DCAF6 CRISPR Knock Out 293T Cell Line (Human)
17709141 1x 10^6 Cells / 1.0 mL

DCAF6 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Mouse Fatty Acid Binding Protein 1, Liver (FABP1) ELISA Kit
abx257541-01 96 Tests

Mouse Fatty Acid Binding Protein 1, Liver (FABP1) ELISA Kit

Sign In for Pricing
View Details
Mouse Fatty Acid Binding Protein 1, Liver (FABP1) ELISA Kit
abx257541-02 5x 96 Tests

Mouse Fatty Acid Binding Protein 1, Liver (FABP1) ELISA Kit

Sign In for Pricing
View Details