Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein encoded by LINC01387 (CR064)

This Recombinant Human Putative uncharacterized protein encoded by LINC01387 (CR064) spans the amino acid sequence from region 1-135. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein encoded by LINC01387 LINC01387 C18orf64

UniProt

J3KSC0

Expression Region

1-135

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVPAPPFLGVLENPVPQWDLSILGSIRIRVSHTEVQGSGSSRSPEALRKESLEVEWTLVLLAIPPRIQPSQQDGGPPKCCDLLRAALLGRHCPLCVPAGEVFSQKRDNEQDRSEFIGQTLKLLVKRNVSLELSCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polystyrene AM NH₂
H12516002.100G 100 g

Polystyrene AM NH₂

Sign In for Pricing
View Details
l-Myc (MYCL) Human qPCR Primer Pair (NM_005376)
HP226575 200 Reactions

l-Myc (MYCL) Human qPCR Primer Pair (NM_005376)

Sign In for Pricing
View Details
Phosphotyrosine (P-Tyr) (PY2870R), CF568 conjugate, 0.1mg/mL
BNC682870-500 1x 500 µL

Phosphotyrosine (P-Tyr) (PY2870R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-Boc-3-azetidinone
TRC-B624560-1G 1 g

1-Boc-3-azetidinone

Sign In for Pricing
View Details
PCNA Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G7]
TA800875BM 100 µL

PCNA Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G7]

Sign In for Pricing
View Details
1-Naphthyl Acetate
TRC-N378675-5G 5 g

1-Naphthyl Acetate

Sign In for Pricing
View Details