Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myoglobin (MYG)

This Recombinant Human Myoglobin (MYG) spans the amino acid sequence from region 2-154. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myoglobin; Nitrite reductase MB; EC 1.7.-.-; Pseudoperoxidase MB; EC 1.11.1.-; MB

UniProt

P02144

Expression Region

2-154

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS804229 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
ATP5PF (NM_001003697) Human Over-expression Lysate
LY423984 100 µg

ATP5PF (NM_001003697) Human Over-expression Lysate

Sign In for Pricing
View Details
VPS52 (NM_001289176) Human Tagged ORF Clone
RG238763 10 µg

VPS52 (NM_001289176) Human Tagged ORF Clone

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS648533 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
DEP1 (PTPRJ) (NM_002843) Human Recombinant Protein
TP322707 20 µg

DEP1 (PTPRJ) (NM_002843) Human Recombinant Protein

Sign In for Pricing
View Details
Benzyl Acetoacetate
TRC-B210020-500MG 500 mg

Benzyl Acetoacetate

Sign In for Pricing
View Details