Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myoglobin (MYG)

This Recombinant Human Myoglobin (MYG) spans the amino acid sequence from region 2-154. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myoglobin; Nitrite reductase MB; EC 1.7.-.-; Pseudoperoxidase MB; EC 1.11.1.-; MB

UniProt

P02144

Expression Region

2-154

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALE Human Gene Knockout Kit (CRISPR)
KN201561LP 1 Kit

GALE Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ki-67 (Proliferating Cell Marker) (MKI67/2462), CF568 conjugate, 0.1mg/mL
BNC682462-500 1x 500 µL

Ki-67 (Proliferating Cell Marker) (MKI67/2462), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CF®350-Dextran 3,500 MW, Anionic and Fixable
#80137 1x 1 mg

CF®350-Dextran 3,500 MW, Anionic and Fixable

Sign In for Pricing
View Details
Recombinant Human B7-H6 Protein (His Tag)
PKSH030461 50 µg

Recombinant Human B7-H6 Protein (His Tag)

Sign In for Pricing
View Details
Fixed Volume Single Channel Micropipette BPIP-535
BPIP-535 1 Unit

Fixed Volume Single Channel Micropipette BPIP-535

Sign In for Pricing
View Details
Vernolate
TRC-V128700-500MG 500 mg

Vernolate

Sign In for Pricing
View Details