Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sex hormone-binding globulin (SHBG)

This Recombinant Human Sex hormone-binding globulin (SHBG) spans the amino acid sequence from region 30-402. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sex hormone-binding globulin; SHBG; Sex steroid-binding protein; SBP; Testis-specific androgen-binding protein; ABP; Testosterone-estradiol-binding globulin; TeBG; Testosterone-estrogen-binding globulin; SHBG

UniProt

P04278

Expression Region

30-402

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF568 conjugate, 0.1mg/mL
BNC680871-500 1x 500 µL

CD71 (66IG10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL
BNC942216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF405S conjugate, 0.1mg/mL
BNC041052-500 1x 500 µL

CD3e (B-B12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (NX2.1/1855R), CF594 conjugate, 0.1mg/mL
BNC941855-500 1x 500 µL

TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (NX2.1/1855R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/1468), CF568 conjugate, 0.1mg/mL
BNC681468-100 1x 100 µL

MCM7 (Proliferation Marker) (MCM7/1468), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), 1mg/mL
BNUM0017-50 1x 50 µL

Ep-CAM / CD326 (VU-1D9), 1mg/mL

Sign In for Pricing
View Details