Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Eosinophil cationic protein (ECP)

This Recombinant Human Eosinophil cationic protein (ECP) spans the amino acid sequence from region 28-160. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Eosinophil cationic protein; ECP; EC 3.1.27.-; Ribonuclease 3; RNase 3; RNASE3 ECP RNS3

UniProt

P12724

Expression Region

28-160

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurofilament A Chicken Polyclonal Antibody
CH22101-100 100 µL

Neurofilament A Chicken Polyclonal Antibody

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (C66/1260), CF568 conjugate, 0.1mg/mL
BNC681260-100 1x 100 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/1260), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Desmoglein-3 (Squamous Cell Marker) (DSG3/2837), CF405S conjugate, 0.1mg/mL
BNC042837-100 1x 100 µL

Desmoglein-3 (Squamous Cell Marker) (DSG3/2837), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AKR1D1 (NM_005989) Human Recombinant Protein
TP323056M 100 µg

AKR1D1 (NM_005989) Human Recombinant Protein

Sign In for Pricing
View Details
ProPette™ LE Starter Kit
P5200-SK 1 Each

ProPette™ LE Starter Kit

Sign In for Pricing
View Details
MBD3L5 (NM_001136507) Human Over-expression Lysate
LC427904 20 µg

MBD3L5 (NM_001136507) Human Over-expression Lysate

Sign In for Pricing
View Details