Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Eosinophil cationic protein (ECP)

This Recombinant Human Eosinophil cationic protein (ECP) spans the amino acid sequence from region 28-160. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Eosinophil cationic protein; ECP; EC 3.1.27.-; Ribonuclease 3; RNase 3; RNASE3 ECP RNS3

UniProt

P12724

Expression Region

28-160

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Coagulation Factor IX / FIX / F9 Protein (His tag)
E53A06520 50 µg

Recombinant Human Coagulation Factor IX / FIX / F9 Protein (His tag)

Sign In for Pricing
View Details
B33D-750-2-7642 AF Systems Consumables
142913 Box of 150 Piece(s)

B33D-750-2-7642 AF Systems Consumables

Sign In for Pricing
View Details
PVDF (Hydrophilic)
MF047-45-PVDF-HL 200 PCS/Box

PVDF (Hydrophilic)

Sign In for Pricing
View Details
Bovine Vascular endothelial growth factor A ELISA Kit
EK1370 Inquire

Bovine Vascular endothelial growth factor A ELISA Kit

Sign In for Pricing
View Details
EGR1-TAR-BSD
LTV-0086-2S 5x10^6

EGR1-TAR-BSD

Sign In for Pricing
View Details
Anti- Tail Fiber Protein(N-terminal) Polyclonal Antibody
AB2G111 0.1mg

Anti- Tail Fiber Protein(N-terminal) Polyclonal Antibody

Sign In for Pricing
View Details