Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cyclin-dependent kinase-like 1 (CDKL1)

This Recombinant Human Cyclin-dependent kinase-like 1 (CDKL1) spans the amino acid sequence from region 1-357. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cyclin-dependent kinase-like 1; EC 2.7.11.22; Protein kinase p42 KKIALRE; Serine/threonine-protein kinase KKIALRE; CDKL1

UniProt

Q00532

Expression Region

1-357

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEHLVKSITWQTLQAVNFCHKHNCIHRDVKPENILITKHSVIKLCDFGFARLLTGPSDYYTDYVATRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISYPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEHNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNYRFPNI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pure Succinyl Canavalia ensiformis Lectin (Jackbean) -Succinyl Con A-
L-1102-25 50 mg

Pure Succinyl Canavalia ensiformis Lectin (Jackbean) -Succinyl Con A-

Sign In for Pricing
View Details
NR3B Rabbit Polyclonal Antibody
HA500134 100 µL

NR3B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS709159 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
Mouse Dffb activation kit by CRISPRa
GA201072 1 Kit

Mouse Dffb activation kit by CRISPRa

Sign In for Pricing
View Details
Decaborane
TRC-D200500-2.5G 2.5 g

Decaborane

Sign In for Pricing
View Details
TNFSF10 Antibody
KC-2610-01 50 μL

TNFSF10 Antibody

Sign In for Pricing
View Details