Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-9 receptor (IL9R), partial

This Recombinant Human Interleukin-9 receptor (IL9R), partial spans the amino acid sequence from region 41-270. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-9 receptor; IL-9 receptor; IL-9R; CD antigen CD129; IL9R

UniProt

Q01113

Expression Region

41-270

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SVTGEGQGPRSRTFTCLTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDPGFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gtpbp3 Mouse qPCR Primer Pair (NM_032544)
MP205805 200 Reactions

Gtpbp3 Mouse qPCR Primer Pair (NM_032544)

Sign In for Pricing
View Details
Decr2 Peptide - C-terminal region (AAP43567)
AAP43567-100UG 100 µg

Decr2 Peptide - C-terminal region (AAP43567)

Sign In for Pricing
View Details
FOXD4L2 (FOXD4L4) Human Gene Knockout Kit (CRISPR)
KN419923 1 Kit

FOXD4L2 (FOXD4L4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Goat Anti-Human IgD ( chain specific)
GWB-D3FCA3 1 mg

Goat Anti-Human IgD ( chain specific)

Sign In for Pricing
View Details
Atg14 CRISPR/Cas9 KO Plasmid (h)
sc-402883 20 µg

Atg14 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Cathepsin LVKH Antibody
orb622211-01 50 μL

Cathepsin LVKH Antibody

Sign In for Pricing
View Details