Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Contactin-2 (CNTN2), partial

This Recombinant Human Contactin-2 (CNTN2), partial spans the amino acid sequence from region 610-708. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Contactin-2; Axonal glycoprotein TAG-1; Axonin-1; Transient axonal glycoprotein 1; TAX-1; CNTN2 AXT TAG1 TAX1

UniProt

Q02246

Expression Region

610-708

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PPGGVVVRDIGDTTIQLSWSRGFDNHSPIAKYTLQARTPPAGKWKQVRTNPANIEGNAETAQVLGLTPWMDYEFRVIASNILGTGEPSGPSSKIRTREA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(+)-Borneol
TRC-B675540-50MG 50 mg

(+)-Borneol

Sign In for Pricing
View Details
(3beta)-Allopregnanolone Sulfate Sodium Salt
TRC-A547125-50MG 50 mg

(3beta)-Allopregnanolone Sulfate Sodium Salt

Sign In for Pricing
View Details
Mouse Rrp1b activation kit by CRISPRa
GA209243 1 Kit

Mouse Rrp1b activation kit by CRISPRa

Sign In for Pricing
View Details
4-Bromo-1-butyl Acetate
TRC-B681965-50G 50 g

4-Bromo-1-butyl Acetate

Sign In for Pricing
View Details
Tissue Total RNA, Lymphoid tissue
CR561895 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details
Human ANKRD36 activation kit by CRISPRa
GA117808 1 Kit

Human ANKRD36 activation kit by CRISPRa

Sign In for Pricing
View Details