Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Contactin-2 (CNTN2), partial

This Recombinant Human Contactin-2 (CNTN2), partial spans the amino acid sequence from region 610-708. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Contactin-2; Axonal glycoprotein TAG-1; Axonin-1; Transient axonal glycoprotein 1; TAX-1; CNTN2 AXT TAG1 TAX1

UniProt

Q02246

Expression Region

610-708

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PPGGVVVRDIGDTTIQLSWSRGFDNHSPIAKYTLQARTPPAGKWKQVRTNPANIEGNAETAQVLGLTPWMDYEFRVIASNILGTGEPSGPSSKIRTREA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STFR P025-600x200-PE-CRD/1 AC Signs
825143 Card of 1 Pictogram(s)

STFR P025-600x200-PE-CRD/1 AC Signs

Sign In for Pricing
View Details
Superose 12 Prep Grade
Su-506C 125 mL

Superose 12 Prep Grade

Sign In for Pricing
View Details
ZNF214 shRNA (h) Lentiviral Particles
sc-96725-V 200 µL

ZNF214 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
C7orf59 Rabbit Polyclonal Antibody (RBITC)
orb1060703 100 µL

C7orf59 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Lenti-EF1a-linc00595-delta383-426-Puro Plasmid
PVT20009 2 µg

Lenti-EF1a-linc00595-delta383-426-Puro Plasmid

Sign In for Pricing
View Details
Anti-Collagen XVII/COL17A1 Antibody Picoband® Fluoro488 Conjugated
A03031-1-Fluoro488 100 µg/Vial

Anti-Collagen XVII/COL17A1 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details