Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 6-pyruvoyl tetrahydrobiopterin synthase (PTPS)

This Recombinant Human 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) spans the amino acid sequence from region 1-145. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

6-pyruvoyl tetrahydrobiopterin synthase; PTP synthase; PTPS; EC 4.2.3.12; PTS

UniProt

Q03393

Expression Region

1-145

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKVYETDNNIVVYKGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fish Sodium Channel Protein Type 10 Subunit Alpha (SCN10A) ELISA Kit
MBS9346144 Inquire

Fish Sodium Channel Protein Type 10 Subunit Alpha (SCN10A) ELISA Kit

Sign In for Pricing
View Details
BMP6 (Bone Morphogenetic Protein 6, BMP-6)
216158 50 µg

BMP6 (Bone Morphogenetic Protein 6, BMP-6)

Sign In for Pricing
View Details
POLRMT Antibody, FITC conjugated
CSB-PA018353LC01HU-01 50 µg

POLRMT Antibody, FITC conjugated

Sign In for Pricing
View Details
POLRMT Antibody, FITC conjugated
CSB-PA018353LC01HU-02 100 µg

POLRMT Antibody, FITC conjugated

Sign In for Pricing
View Details
Goat Forkhead Box Protein C1 ELISA kit
GTR10429945 96 Well

Goat Forkhead Box Protein C1 ELISA kit

Sign In for Pricing
View Details
KRTAP19-1 3'UTR Luciferase Stable Cell Line
TU012181 1.0 mL

KRTAP19-1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details