Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adiponectin (ADIPO)

This Recombinant Human Adiponectin (ADIPO) spans the amino acid sequence from region 19-244. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adiponectin; 30 kDa adipocyte complement-related protein; Adipocyte complement-related 30 kDa protein; ACRP30; Adipocyte, C1q and collagen domain-containing protein; Adipose most abundant gene transcript 1 protein; apM-1; Gelatin-binding protein; ADIPOQ ACDC ACRP30 APM1 GBP28

UniProt

Q15848

Expression Region

19-244

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRF1 (NRF1/2609), 1mg/mL
BNUM2609-50 1x 50 µL

NRF1 (NRF1/2609), 1mg/mL

Sign In for Pricing
View Details
XIAP Antibody (Biotin)
KB-3637-01 50 μL

XIAP Antibody (Biotin)

Sign In for Pricing
View Details
XIAP Antibody (Biotin)
KB-3637-02 100 µL

XIAP Antibody (Biotin)

Sign In for Pricing
View Details
XIAP Antibody (Biotin)
KB-3637-03 1 mL

XIAP Antibody (Biotin)

Sign In for Pricing
View Details
2',5'-Dideoxyuridine
TRC-D440928-1MG 1 mg

2',5'-Dideoxyuridine

Sign In for Pricing
View Details
P21 / WAF1 (CIP1/823), CF488A conjugate, 0.1mg/mL
BNC880823-500 1x 500 µL

P21 / WAF1 (CIP1/823), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details