Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ribosomal RNA-processing protein 7 homolog A (RRP7A)

This Recombinant Human Ribosomal RNA-processing protein 7 homolog A (RRP7A) spans the amino acid sequence from region 1-280. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ribosomal RNA-processing protein 7 homolog A; Gastric cancer antigen Zg14; RRP7A CGI-96

UniProt

Q9Y3A4

Expression Region

1-280

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVARRRKCAARDPEDRIPSPLGYAAIPIKFSEKQQASHYLYVRAHGVRQGTKSTWPQKRTLFVLNVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVPGFQVAYVVFQKPSGVSAALALKGPLLVSTESHPVKSGIHKWISDYADSVPDPEALRVEVDTFMEAYDQKIAEEEAKAKEEEGVPDEEGWVKVTRRGRRPVLPRTEAASLRVLERERRKRSRKELLNFYAWQHRESKMEHLAQLRKKFEEDKQRIELLRAQRKFRPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HS6ST2 CRISPRa sgRNA lentivector (set of three targets)(Human)
23919121 3x 1.0µg DNA

HS6ST2 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
CECR2 Antibody - N-terminal region (ARP79665_P050)
ARP79665_P050 100 µL

CECR2 Antibody - N-terminal region (ARP79665_P050)

Sign In for Pricing
View Details
XPO5 antibody - N-terminal region
MBS3208692-01 0.1 mL

XPO5 antibody - N-terminal region

Sign In for Pricing
View Details
XPO5 antibody - N-terminal region
MBS3208692-02 5x 0.1 mL

XPO5 antibody - N-terminal region

Sign In for Pricing
View Details
5-Bromo-4-methoxypicolinonitrile
OR1032119-01 250 mg

5-Bromo-4-methoxypicolinonitrile

Sign In for Pricing
View Details
5-Bromo-4-methoxypicolinonitrile
OR1032119-02 1 g

5-Bromo-4-methoxypicolinonitrile

Sign In for Pricing
View Details