Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable RNA-binding protein 19 (RBM19), partial

This Recombinant Human Probable RNA-binding protein 19 (RBM19), partial spans the amino acid sequence from region 730-811. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable RNA-binding protein 19; RNA-binding motif protein 19; RBM19 KIAA0682

UniProt

Q9Y4C8

Expression Region

730-811

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CTLFIKNLNFDTTEEKLKEVFSKVGTVKSCSISKKKNKAGVLLSMGFGFVEYRKPEQAQKALKQLQGHVVDGHKLEVRISER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycosylated Serum Protein (GSP) Colorimetric Assay Kit
E-BC-K069-M-01 48 T (42 samples)

Glycosylated Serum Protein (GSP) Colorimetric Assay Kit

Sign In for Pricing
View Details
Glycosylated Serum Protein (GSP) Colorimetric Assay Kit
E-BC-K069-M-02 96 T (90 samples)

Glycosylated Serum Protein (GSP) Colorimetric Assay Kit

Sign In for Pricing
View Details
Human ZNF566 activation kit by CRISPRa
GA113771 1 Kit

Human ZNF566 activation kit by CRISPRa

Sign In for Pricing
View Details
FITC Conjugated Phaseolus lunatus Lectin (Lima Bean) -LBA-
F-1701-2 2 mg

FITC Conjugated Phaseolus lunatus Lectin (Lima Bean) -LBA-

Sign In for Pricing
View Details
ROBO4 Rabbit Polyclonal Antibody
TA361324 100 µL

ROBO4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Perfluorobutylphosphonic Acid
TRC-P287595-50MG 50 mg

Perfluorobutylphosphonic Acid

Sign In for Pricing
View Details