Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adhesion G-protein coupled receptor G1 (AGRG1), partial

This Recombinant Human Adhesion G-protein coupled receptor G1 (AGRG1), partial spans the amino acid sequence from region 26-401. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adhesion G-protein coupled receptor G1; G-protein coupled receptor 56; [Cleaved into: Adhesion G-protein coupled receptor G1, N-terminal fragment; ADGRG1 N-terminal fragment; ADGRG1 NT; GPR56 N-terminal fragment; GPR56 NT; GPR56 (N; GPR56 extracellular subunit; GPR56 subunit alpha; Adhesion G-protein coupled receptor G1, C-terminal fragment; ADGRG1 C-terminal fragment; ADGRG1 CT; GPR56 C-terminal fragment; GPR56 CT; GPR56 (C; GPR56 seven-transmembrane subunit; GPR56 7TM; GPR56 subunit beta] ADGRG1 GPR56 TM7LN4 TM7XN1 UNQ540/PRO1083

UniProt

Q9Y653

Expression Region

26-401

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAPFPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLAQGPPLLATSVTSWWSPQNISLPSAASFTFSFHSPPHTAAHNASVDMCELKRDLQLLSQFLKHPQKASRRPSAAPASQQLQSLESKLTSVRFMGDMVSFEEDRINATVWKLQPTAGLQDLHIHSRQEEEQSEIMEYSVLLPRTLFQRTKGRSGEAEKRLLLVDFSSQALFQDKNSSQVLGEKVLGIVVQNTKVANLTEPVVLTFQHQLQPKNVTLQCVFWVEDPTLSSPGHWSSAGCETVRRETQTSCFCNHLTYFAVLMVSSVEVDAVHKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Avidin-related protein 7, AVR7 ELISA KIT
ELI-12022c 96 Tests

Chicken Avidin-related protein 7, AVR7 ELISA KIT

Sign In for Pricing
View Details
Altretamine 50mg
A10059-50 50 mg

Altretamine 50mg

Sign In for Pricing
View Details
Anti-C11orf57 antibody
PAab01006 100 µg

Anti-C11orf57 antibody

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Cadherin, Neuronal (CDH2)
MBS2055740-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Cadherin, Neuronal (CDH2)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Cadherin, Neuronal (CDH2)
MBS2055740-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Cadherin, Neuronal (CDH2)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Cadherin, Neuronal (CDH2)
MBS2055740-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Cadherin, Neuronal (CDH2)

Sign In for Pricing
View Details