Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Poly-ADP-ribosylation-amplifying and CtIP-maintaining micropeptide (PACMP)

This Recombinant Human Poly-ADP-ribosylation-amplifying and CtIP-maintaining micropeptide (PACMP) spans the amino acid sequence from region 1-44. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Poly-ADP-ribosylation-amplifying and CtIP-maintaining micropeptide; PAR-amplifying and CtIP-maintaining micropeptide; MARCHF6-DT PACMP

UniProt

P0DW81

Expression Region

1-44

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAASGGTKKAQSGGRRLREPSSRPSRRARQRPRRGALRKAGRFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ngf Mouse shRNA Lentiviral Particle (Locus ID 18049)
TL510273V 500 µL Each

Ngf Mouse shRNA Lentiviral Particle (Locus ID 18049)

Sign In for Pricing
View Details
Emt Lentiviral Activation Particles (h2)
sc-402628-LAC-2 200 µL

Emt Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Recombinant Human GPR135 Protein
E30P5208 20 µg

Recombinant Human GPR135 Protein

Sign In for Pricing
View Details
SESN3 Blocking Peptide
MBS9621439-01 1 mg

SESN3 Blocking Peptide

Sign In for Pricing
View Details
SESN3 Blocking Peptide
MBS9621439-02 5x 1 mg

SESN3 Blocking Peptide

Sign In for Pricing
View Details
ASPP2 Recombinant Antibody, PerCP Conjugated
bsm-61402R-PerCP-TR 20 µL

ASPP2 Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details