Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Centrosomal protein of 170 kDa protein B (C170B), partial

This Recombinant Human Centrosomal protein of 170 kDa protein B (C170B), partial spans the amino acid sequence from region 23-73. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Centrosomal protein of 170 kDa protein B; Centrosomal protein 170B; Cep170B; CEP170B FAM68C KIAA0284

UniProt

Q9Y4F5

Expression Region

23-73

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IFVGREECELMLQSRSVDKQHAVINYDQDRDEHWVKDLGSLNGTFVNDMRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human LIG1 shRNA (UAS) - Lentiviral human LIG1 shRNA (UAS, RFP) (25)
GTR15143087 1 Vial

Lentiviral human LIG1 shRNA (UAS) - Lentiviral human LIG1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS551859 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Goat anti-SNAP23 Antibody
MBS422433-01 0.1 mg

Goat anti-SNAP23 Antibody

Sign In for Pricing
View Details
Goat anti-SNAP23 Antibody
MBS422433-02 5x 0.1 mg

Goat anti-SNAP23 Antibody

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized membrane protein yteJ (yteJ)
MBS1082631 Inquire

Recombinant Bacillus subtilis Uncharacterized membrane protein yteJ (yteJ)

Sign In for Pricing
View Details
Human Vascular Endothelial Growth Factor C (VEGFC) ELISA Kit
abx153469-01 96 Tests

Human Vascular Endothelial Growth Factor C (VEGFC) ELISA Kit

Sign In for Pricing
View Details