Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 4-60 (LV460)

This Recombinant Human Immunoglobulin lambda variable 4-60 (LV460) spans the amino acid sequence from region 22-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 4-60 IGLV4-60

UniProt

A0A075B6I1

Expression Region

22-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQSSSASASLGSSVKLTCTLSSGHSSYIIAWHQQQPGKAPRYLMKLEGSGSYNKGSGVPDRFSGSSSGADRYLTISNLQFEDEADYYCETWDSNT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD81 recombinant protein
PX-P6352 100 µg

Human CD81 recombinant protein

Sign In for Pricing
View Details
Caspase-1 P10 Antibody FITC Conjugated
orb1543759 100 µL

Caspase-1 P10 Antibody FITC Conjugated

Sign In for Pricing
View Details
RPS7 siRNA (Rat)
MBS8233378-01 15 nmol

RPS7 siRNA (Rat)

Sign In for Pricing
View Details
RPS7 siRNA (Rat)
MBS8233378-02 30 nmol

RPS7 siRNA (Rat)

Sign In for Pricing
View Details
RPS7 siRNA (Rat)
MBS8233378-03 5x 30 nmol

RPS7 siRNA (Rat)

Sign In for Pricing
View Details
Tert-Amyl 2-acetamido-2-deoxy-b-D-glucopyranoside
292269-01 1 g

Tert-Amyl 2-acetamido-2-deoxy-b-D-glucopyranoside

Sign In for Pricing
View Details