Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 4-60 (LV460)

This Recombinant Human Immunoglobulin lambda variable 4-60 (LV460) spans the amino acid sequence from region 22-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 4-60 IGLV4-60

UniProt

A0A075B6I1

Expression Region

22-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQSSSASASLGSSVKLTCTLSSGHSSYIIAWHQQQPGKAPRYLMKLEGSGSYNKGSGVPDRFSGSSSGADRYLTISNLQFEDEADYYCETWDSNT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purose 6 Fast Flow
E23-10102-06 100 mL

Purose 6 Fast Flow

Sign In for Pricing
View Details
PRR24, CT (PRR24, Proline-rich protein 24) (AP)
MBS6337765-01 0.2 mL

PRR24, CT (PRR24, Proline-rich protein 24) (AP)

Sign In for Pricing
View Details
PRR24, CT (PRR24, Proline-rich protein 24) (AP)
MBS6337765-02 5x 0.2 mL

PRR24, CT (PRR24, Proline-rich protein 24) (AP)

Sign In for Pricing
View Details
Centrifugal Concentrators , PES Membrane, 3K , Grey
LC9101-050 50 / Pack

Centrifugal Concentrators , PES Membrane, 3K , Grey

Sign In for Pricing
View Details
Human CNMD Pre-designed siRNA Set B
SI003315B 1 Each

Human CNMD Pre-designed siRNA Set B

Sign In for Pricing
View Details
HSP90 alpha / beta Antibody (ATTO488)
abx448253 100 µg

HSP90 alpha / beta Antibody (ATTO488)

Sign In for Pricing
View Details