Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 3-12 (LV312)

This Recombinant Human Immunoglobulin lambda variable 3-12 (LV312) spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 3-12 IGLV3-12

UniProt

A0A075B6K2

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YELTQPHSVSVATAQMARITCGGNNIGSKAVHWYQQKPGQDPVLVIYSDSNRPSGIPERFSGSNPGNTATLTISRIEAGDEADYYCQVWDSSSDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse 11-Dehydrothromboxane B2 (11-DH-TXB2) ELISA Kit
MBS264288-01 48 Well

Mouse 11-Dehydrothromboxane B2 (11-DH-TXB2) ELISA Kit

Sign In for Pricing
View Details
Mouse 11-Dehydrothromboxane B2 (11-DH-TXB2) ELISA Kit
MBS264288-02 96 Well

Mouse 11-Dehydrothromboxane B2 (11-DH-TXB2) ELISA Kit

Sign In for Pricing
View Details
Mouse 11-Dehydrothromboxane B2 (11-DH-TXB2) ELISA Kit
MBS264288-03 5x 96 Well

Mouse 11-Dehydrothromboxane B2 (11-DH-TXB2) ELISA Kit

Sign In for Pricing
View Details
Mouse 11-Dehydrothromboxane B2 (11-DH-TXB2) ELISA Kit
MBS264288-04 10x 96 Well

Mouse 11-Dehydrothromboxane B2 (11-DH-TXB2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae Elongation factor G (fusA), partial
MBS1242248 Inquire

Recombinant Streptococcus pneumoniae Elongation factor G (fusA), partial

Sign In for Pricing
View Details
Hemoglobin α1 CRISPR/Cas9 KO Plasmid (m2)
sc-420800-KO-2 20 µg

Hemoglobin α1 CRISPR/Cas9 KO Plasmid (m2)

Sign In for Pricing
View Details