Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 2 (TRGV2)

This Recombinant Human T cell receptor gamma variable 2 (TRGV2) spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 2 TRGV2 TCRGV2

UniProt

A0A075B6R0

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGRTKSVIRQTGSSAEITCDLAEGSNGYIHWYLHQEGKAPQRLQYYDSYNSKVVLESGVSPGKYYTYASTRNNLRLILRNLIENDFGVYYCATWDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Pleura
CS501799 5x 5 µm

Frozen Tissue Sections, Pleura

Sign In for Pricing
View Details
SUGT1 (NM_001130912) Human Over-expression Lysate
LY427302 100 µg

SUGT1 (NM_001130912) Human Over-expression Lysate

Sign In for Pricing
View Details
Cbx8 Mouse Gene Knockout Kit (CRISPR)
KN502616 1 Kit

Cbx8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin, pan (Epithelial Marker) (PCK/3150), CF640R conjugate, 0.1mg/mL
BNC403150-100 1x 100 µL

Cytokeratin, pan (Epithelial Marker) (PCK/3150), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GJD2 Rabbit Polyclonal Antibody
TA366793 100 µL

GJD2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
7-[4-[4-(2-Fluorophenyl)-1-piperazinyl]butoxy]-3,4-dihydro-2(1H)-quinolinone
TRC-F073060-1G 1 g

7-[4-[4-(2-Fluorophenyl)-1-piperazinyl]butoxy]-3,4-dihydro-2(1H)-quinolinone

Sign In for Pricing
View Details