Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor gamma variable 2 (TRGV2)

This Recombinant Human T cell receptor gamma variable 2 (TRGV2) spans the amino acid sequence from region 18-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor gamma variable 2 TRGV2 TCRGV2

UniProt

A0A075B6R0

Expression Region

18-118

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KSSNLEGRTKSVIRQTGSSAEITCDLAEGSNGYIHWYLHQEGKAPQRLQYYDSYNSKVVLESGVSPGKYYTYASTRNNLRLILRNLIENDFGVYYCATWDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kallikrein 8 (KLK8) (NM_144505) Human Over-expression Lysate
LY430111 100 µg

Kallikrein 8 (KLK8) (NM_144505) Human Over-expression Lysate

Sign In for Pricing
View Details
Additional platform separators (4 ea.) . Adds 1.25" to platform separation
BR2000-SP 1 Each

Additional platform separators (4 ea.) . Adds 1.25" to platform separation

Sign In for Pricing
View Details
TBXAS1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H9]
TA501357BM 100 µL

TBXAS1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H9]

Sign In for Pricing
View Details
G-CSF Receptor Antibody
KC-1271-01 50 μL

G-CSF Receptor Antibody

Sign In for Pricing
View Details
G-CSF Receptor Antibody
KC-1271-02 100 µL

G-CSF Receptor Antibody

Sign In for Pricing
View Details
G-CSF Receptor Antibody
KC-1271-03 1 mL

G-CSF Receptor Antibody

Sign In for Pricing
View Details