Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 7 (TVA7)

This Recombinant Human T cell receptor alpha variable 7 (TVA7) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 7 TRAV7

UniProt

A0A075B6U4

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ENQVEHSPHFLGPQQGDVASMSCTYSVSRFNNLQWYRQNTGMGPKHLLSMYSAGYEKQKGRLNATLLKNGSSLYITAVQPEDSATYFCAVD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC20 Rabbit pAb, PerCP-Cy7 conjugated
orb2870063 100 µL

LRRC20 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Anti Monkey IgA Pab
121107 1 mg

Anti Monkey IgA Pab

Sign In for Pricing
View Details
Recombinant human THOC7 protein
ATGP2943-050 50 µg

Recombinant human THOC7 protein

Sign In for Pricing
View Details
Phosphate Buffered Saline (PBS), Ready to Use, 2 Packs
PC0711-2pk 2 PCKS

Phosphate Buffered Saline (PBS), Ready to Use, 2 Packs

Sign In for Pricing
View Details
HSPA4L siRNA (Human)
CRH7792-01 15 nmol

HSPA4L siRNA (Human)

Sign In for Pricing
View Details
HSPA4L siRNA (Human)
CRH7792-02 30 nmol

HSPA4L siRNA (Human)

Sign In for Pricing
View Details