Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 7 (TVA7)

This Recombinant Human T cell receptor alpha variable 7 (TVA7) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 7 TRAV7

UniProt

A0A075B6U4

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ENQVEHSPHFLGPQQGDVASMSCTYSVSRFNNLQWYRQNTGMGPKHLLSMYSAGYEKQKGRLNATLLKNGSSLYITAVQPEDSATYFCAVD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Nitrosomonas eutropha Glutamate-ammonia-ligase adenylyltransferase (glnE), partial
MBS1337351 Inquire

Recombinant Nitrosomonas eutropha Glutamate-ammonia-ligase adenylyltransferase (glnE), partial

Sign In for Pricing
View Details
Mouse Monoclonal TIM-4 Antibody (921832R) [DyLight 680]
FAB2929RY 0.1 mL

Mouse Monoclonal TIM-4 Antibody (921832R) [DyLight 680]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Pancreas
CB519280 1 Block

Frozen Tissue Blocks, Pancreas

Sign In for Pricing
View Details
ErbB 4 (ERBB4) (NM_001042599) Human Recombinant Protein
PH34691M5 20 µg

ErbB 4 (ERBB4) (NM_001042599) Human Recombinant Protein

Sign In for Pricing
View Details
POMC Protein Lysate
OCOA15864-20UG 20 µg

POMC Protein Lysate

Sign In for Pricing
View Details
AVP Polyclonal Antibody
A71485-100 100 µL

AVP Polyclonal Antibody

Sign In for Pricing
View Details