Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 7 (TVA7)

This Recombinant Human T cell receptor alpha variable 7 (TVA7) spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 7 TRAV7

UniProt

A0A075B6U4

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ENQVEHSPHFLGPQQGDVASMSCTYSVSRFNNLQWYRQNTGMGPKHLLSMYSAGYEKQKGRLNATLLKNGSSLYITAVQPEDSATYFCAVD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF156 (MGRN1) (NM_015246) Human Tagged Lenti ORF Clone
RC208284L3 10 µg

RNF156 (MGRN1) (NM_015246) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
BLLF1 Antibody; HRP conjugated
MBS7002062-01 0.05 mg

BLLF1 Antibody; HRP conjugated

Sign In for Pricing
View Details
BLLF1 Antibody; HRP conjugated
MBS7002062-02 0.1 mg

BLLF1 Antibody; HRP conjugated

Sign In for Pricing
View Details
BLLF1 Antibody; HRP conjugated
MBS7002062-03 5x 0.1 mg

BLLF1 Antibody; HRP conjugated

Sign In for Pricing
View Details
Wisteria floribunda Lectin (WFA/WFL) - Alexa Fluor 594
21511577-1 1 mg

Wisteria floribunda Lectin (WFA/WFL) - Alexa Fluor 594

Sign In for Pricing
View Details
GUK1 Recombinant Protein (Human)
OPCA04215-20UG 20 µg

GUK1 Recombinant Protein (Human)

Sign In for Pricing
View Details