Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 9-2 (TVA92)

This Recombinant Human T cell receptor alpha variable 9-2 (TVA92) spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 9-2 TRAV9-2

UniProt

A0A087WT02

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSVTQMEGPVTLSEEAFLTINCTYTATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKGFEATYRKETTSFHLEKGSVQVSDSAVYFCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELAVL3 Antibody
KC-17232-01 50 μL

ELAVL3 Antibody

Sign In for Pricing
View Details
ELAVL3 Antibody
KC-17232-02 100 µL

ELAVL3 Antibody

Sign In for Pricing
View Details
ELAVL3 Antibody
KC-17232-03 1 mL

ELAVL3 Antibody

Sign In for Pricing
View Details
Sambucus nigra -SNA-I- Immobilized Lectin
A-6802-2 2 mL

Sambucus nigra -SNA-I- Immobilized Lectin

Sign In for Pricing
View Details
Rat Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) ELISA Kit
RD-VEGFR1-Ra-01 96 Tests

Rat Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) ELISA Kit

Sign In for Pricing
View Details
Rat Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) ELISA Kit
RD-VEGFR1-Ra-02 48 Tests

Rat Vascular Endothelial Growth Factor Receptor 1 (VEGFR1) ELISA Kit

Sign In for Pricing
View Details